Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries) |
Domain d7a0vd1: 7a0v D:1-121 [396812] Other proteins in same PDB: d7a0vb2, d7a0vd2, d7a0vf2 automated match to d4nc2b_ complexed with gol, mg, po4 |
PDB Entry: 7a0v (more details), 2.3 Å
SCOPe Domain Sequences for d7a0vd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a0vd1 b.1.1.0 (D:1-121) automated matches {Llama (Lama glama) [TaxId: 9844]} qvqlvesgggfaqaggslrlscaasgstfrframgwfrqapgkerefvagiswsgstkyt dsvkgrftisrdnakntvhlqmnnltpedtavyycaqsraieaddsrgydywgqgtqvtv s
Timeline for d7a0vd1:
View in 3D Domains from other chains: (mouse over for more information) d7a0vb1, d7a0vb2, d7a0vf1, d7a0vf2 |