Lineage for d7a0vd1 (7a0v D:1-121)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369702Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2369721Domain d7a0vd1: 7a0v D:1-121 [396812]
    Other proteins in same PDB: d7a0vb2, d7a0vd2, d7a0vf2
    automated match to d4nc2b_
    complexed with gol, mg, po4

Details for d7a0vd1

PDB Entry: 7a0v (more details), 2.3 Å

PDB Description: crystal structure of the 5-phosphatase domain of synaptojanin1 in complex with a nanobody
PDB Compounds: (D:) Nanobody 13015

SCOPe Domain Sequences for d7a0vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7a0vd1 b.1.1.0 (D:1-121) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesgggfaqaggslrlscaasgstfrframgwfrqapgkerefvagiswsgstkyt
dsvkgrftisrdnakntvhlqmnnltpedtavyycaqsraieaddsrgydywgqgtqvtv
s

SCOPe Domain Coordinates for d7a0vd1:

Click to download the PDB-style file with coordinates for d7a0vd1.
(The format of our PDB-style files is described here.)

Timeline for d7a0vd1: