SCOPe 2.07: Domain d7a5ca1: 7a5c A:1-299

Lineage for d7a5ca1 (7a5c A:1-299)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (158 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:243277] [268805] (2 PDB entries)

8. Domain d7a5ca1: 7a5c A:1-299 [396809]
   Other proteins in same PDB: d7a5ca2, d7a5cb2
   automated match to d5ltca_
   complexed with gol

Details for d7a5ca1

PDB Entry: 7a5c, 2.2 Å

PDB Description: crystal structure of spin labelled vcsiap r125a bound to an artificial peptide ligand.

PDB Compounds: (A:) Sialic acid-binding periplasmic protein siaP

SCOPe Domain Sequences for d7a5ca1:

Sequence; same for both SEQRES and ATOM records:

>d7a5ca1 c.94.1.0 (A:1-299) automated matches {Vibrio cholerae [TaxId: 243277]}
attlkmgmqasvgsveynsakmladtleemsqgeiklalypsaqlgddramlqcltlgdl
dityaefgrmglwipraeavmlpyvakdfdhlrrmfesdfgqgvrdemlqkfnwraldtw
yngtaettsnrplnsiedfkglklrvpnakqnlnyaklsgasptpmsfsevycalqtnav
dgqenplptiktmkfyevqknlamthhivndqmviisestwqklsdtdkdiiqkavqkvg
dahtqtvktqeaelvsffkseginvtypdlepfreamqplykefdsnigqpivsklaam

Timeline for d7a5ca1:

• d7a5ca1 is new in SCOPe 2.07-stable
  
• d7a5ca1 appears in the current release, SCOPe 2.08