Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [268805] (2 PDB entries) |
Domain d7a5ca1: 7a5c A:1-299 [396809] Other proteins in same PDB: d7a5ca2, d7a5cb2 automated match to d5ltca_ complexed with gol |
PDB Entry: 7a5c (more details), 2.2 Å
SCOPe Domain Sequences for d7a5ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7a5ca1 c.94.1.0 (A:1-299) automated matches {Vibrio cholerae [TaxId: 243277]} attlkmgmqasvgsveynsakmladtleemsqgeiklalypsaqlgddramlqcltlgdl dityaefgrmglwipraeavmlpyvakdfdhlrrmfesdfgqgvrdemlqkfnwraldtw yngtaettsnrplnsiedfkglklrvpnakqnlnyaklsgasptpmsfsevycalqtnav dgqenplptiktmkfyevqknlamthhivndqmviisestwqklsdtdkdiiqkavqkvg dahtqtvktqeaelvsffkseginvtypdlepfreamqplykefdsnigqpivsklaam
Timeline for d7a5ca1: