SCOPe 2.07: Domain d6ze8d2: 6ze8 D:267-334

Lineage for d6ze8d2 (6ze8 D:267-334)

Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
Fold d.26: FKBP-like [54533] (3 superfamilies)
core: beta(2)-alpha-beta(2); antiparallel beta-sheet
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
Protein Chitotriosidase [82628] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [82629] (11 PDB entries)
Domain d6ze8d2: 6ze8 D:267-334 [396797]
Other proteins in same PDB: d6ze8a1, d6ze8b1, d6ze8c1, d6ze8d1, d6ze8e1, d6ze8f1
automated match to d1lq0a2
complexed with gol, na, qgb

Details for d6ze8d2

PDB Entry: 6ze8 (more details), 1.5 Å

PDB Description: crystal structure of human chitotriosidase-1 (hchit) catalytic domain in complex with compound oatd-01

PDB Compounds: (D:) chitotriosidase-1

SCOPe Domain Sequences for d6ze8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ze8d2 d.26.3.1 (D:267-334) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwvgf

SCOPe Domain Coordinates for d6ze8d2:

Click to download the PDB-style file with coordinates for d6ze8d2.
(The format of our PDB-style files is described here.)

Timeline for d6ze8d2: