Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (30 species) not a true protein |
Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (4 PDB entries) |
Domain d6zlff2: 6zlf F:256-408 [396690] Other proteins in same PDB: d6zlfa1, d6zlff1, d6zlfg1, d6zlfh1, d6zlfi1, d6zlfj1, d6zlfk1, d6zlfl1 automated match to d2ohha2 complexed with cl, feo, fmn, hez, kr |
PDB Entry: 6zlf (more details), 1.8 Å
SCOPe Domain Sequences for d6zlff2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zlff2 c.23.5.0 (F:256-408) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]} ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev ldeyelyyvptedelekcynmgkrlavkvkemk
Timeline for d6zlff2: