Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (13 species) not a true protein |
Species Equus caballus [TaxId:9796] [396658] (2 PDB entries) |
Domain d6zj9a2: 6zj9 A:81-222 [396659] Other proteins in same PDB: d6zj9a1 automated match to d1k3ya1 complexed with edo, gsh |
PDB Entry: 6zj9 (more details), 2.2 Å
SCOPe Domain Sequences for d6zj9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zj9a2 a.45.1.1 (A:81-222) automated matches {Equus caballus [TaxId: 9796]} lygkdikeralidmyiegvadlnemilllpitppaekdakimlikdrttnrylpafekvl kshgedylvgnrlsradihlvellylveeldpslltnfpllkalkarisnlptvkkflqp ggarkppgdeksveksrkifkf
Timeline for d6zj9a2: