SCOPe 2.07: Domain d6yp9a1: 6yp9 A:3-146

Lineage for d6yp9a1 (6yp9 A:3-146)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d6yp9a1: 6yp9 A:3-146 [396651]
   Other proteins in same PDB: d6yp9b_
   automated match to d1qz5a1
   complexed with atp, ca

Details for d6yp9a1

PDB Entry: 6yp9, 2.56 Å

PDB Description: rabbit muscle actin in complex with adf-h and atp-atto-488

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6yp9a1:

Sequence, based on SEQRES records:

>d6yp9a1 c.55.1.1 (A:3-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskr
giltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqi
mfetfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d6yp9a1 c.55.1.1 (A:3-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dettalvcdngsglvkagfagddapravfpsivgrprdsyvgdeaqskrgiltlkypieh
giitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamy
vaiqavlslyasg

Timeline for d6yp9a1:

• d6yp9a1 is new in SCOPe 2.07-stable
  
• d6yp9a1 appears in the current release, SCOPe 2.08