SCOPe 2.07: Domain d6z8la1: 6z8l A:1-408

Lineage for d6z8la1 (6z8l A:1-408)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (33 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225770] (14 PDB entries)

8. Domain d6z8la1: 6z8l A:1-408 [396642]
   Other proteins in same PDB: d6z8la2
   automated match to d3baxa2
   complexed with ca, cl, glc

Details for d6z8la1

PDB Entry: 6z8l, 1.4 Å

PDB Description: alpha-amylase in complex with probe fragments

PDB Compounds: (A:) Pancreatic alpha-amylase

SCOPe Domain Sequences for d6z8la1:

Sequence; same for both SEQRES and ATOM records:

>d6z8la1 c.1.8.1 (A:1-408) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdgqpftn

Timeline for d6z8la1:

• d6z8la1 is new in SCOPe 2.07-stable
  
• d6z8la1 appears in the current release, SCOPe 2.08