SCOPe 2.07: Domain d6ybqe1: 6ybq E:5-249

Lineage for d6ybqe1 (6ybq E:5-249)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (70 species)
   not a true protein

7. Species Methylorubrum extorquens [TaxId:272630] [396415] (1 PDB entry)

8. Domain d6ybqe1: 6ybq E:5-249 [396468]
   automated match to d1x0ua1
   complexed with bti, coa; mutant

Details for d6ybqe1

PDB Entry: 6ybq, 1.96 Å

PDB Description: engineered glycolyl-coa carboxylase (quintuple mutant) with bound coa

PDB Compounds: (E:) Propionyl-CoA carboxylase beta chain

SCOPe Domain Sequences for d6ybqe1:

Sequence; same for both SEQRES and ATOM records:

>d6ybqe1 c.14.1.0 (E:5-249) automated matches {Methylorubrum extorquens [TaxId: 272630]}
lekleerraqarlgggekrleaqhkrgkltareriellldhgsfeefdmfvqhrstdfgm
ekqkipgdgvvtgwgtvngrtvflfskdftvfggssseahaakivkvqdmalkmrapiig
ifdaggariqegvaalgghgevfrrnvaasgvipqisvimgpcaggdvyspamtdfifmv
rdtsymfvtgpdvvktvtnevvtaeelggakvhtskssiadgsfendveailqirrlldf
lpann

Timeline for d6ybqe1:

• d6ybqe1 is new in SCOPe 2.07-stable
  
• d6ybqe1 appears in the current release, SCOPe 2.08