SCOPe 2.07: Domain d6xp4e1: 6xp4 E:1-153

Lineage for d6xp4e1 (6xp4 E:1-153)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (19 species)
   not a true protein

7. Species Aspergillus fumigatus [TaxId:330879] [365715] (8 PDB entries)

8. Domain d6xp4e1: 6xp4 E:1-153 [396335]
   Other proteins in same PDB: d6xp4a2, d6xp4b2, d6xp4c2, d6xp4d2, d6xp4e2, d6xp4f2
   automated match to d4fkxa_

Details for d6xp4e1

PDB Entry: 6xp4, 2 Å

PDB Description: nucleoside diphosphate kinase from aspergillus fumgiatus af293

PDB Compounds: (E:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d6xp4e1:

Sequence; same for both SEQRES and ATOM records:

>d6xp4e1 d.58.6.0 (E:1-153) automated matches {Aspergillus fumigatus [TaxId: 330879]}
msneqtfiaikpdgvqrgligpiisrfenrgfklvamklvsppqsqleqhyadlsdkpff
kglvsymlsgpicamvwegrdvvktgrtilgatnplasapgtirgdfaidvgrnvchgsd
svenakkeialwfkpeeliswksatfdwvyeka

Timeline for d6xp4e1:

• d6xp4e1 is new in SCOPe 2.07-stable
  
• d6xp4e1 appears in the current release, SCOPe 2.08