Lineage for d1rbos_ (1rbo S:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564397Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2564398Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2564399Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2564400Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (9 species)
  7. 2564482Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 2564494Domain d1rbos_: 1rbo S: [39633]
    Other proteins in same PDB: d1rbob1, d1rbob2, d1rboe1, d1rboe2, d1rboh1, d1rboh2, d1rbol1, d1rbol2
    complexed with cap

Details for d1rbos_

PDB Entry: 1rbo (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate
PDB Compounds: (S:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rbos_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rbos_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1rbos_:

Click to download the PDB-style file with coordinates for d1rbos_.
(The format of our PDB-style files is described here.)

Timeline for d1rbos_: