Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (19 species) not a true protein |
Species Aspergillus fumigatus [TaxId:330879] [365715] (8 PDB entries) |
Domain d6xpwe1: 6xpw E:1-153 [396279] Other proteins in same PDB: d6xpwa2, d6xpwb2, d6xpwc2, d6xpwe2, d6xpwg2, d6xpwh2 automated match to d4fkxa_ complexed with cdp, po4 |
PDB Entry: 6xpw (more details), 1.9 Å
SCOPe Domain Sequences for d6xpwe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6xpwe1 d.58.6.0 (E:1-153) automated matches {Aspergillus fumigatus [TaxId: 330879]} msneqtfiaikpdgvqrgligpiisrfenrgfklvamklvsppqsqleqhyadlsdkpff kglvsymlsgpicamvwegrdvvktgrtilgatnplasapgtirgdfaidvgrnvchgsd svenakkeialwfkpeeliswksatfdwvyeka
Timeline for d6xpwe1: