SCOPe 2.07: Domain d6wegc2: 6weg C:80-194

Lineage for d6wegc2 (6weg C:80-194)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (71 species)
   not a true protein

7. Species Francisella tularensis [TaxId:177416] [396134] (1 PDB entry)

8. Domain d6wegc2: 6weg C:80-194 [396135]
   Other proteins in same PDB: d6wegc1, d6wegc3, d6wegd1, d6wegd3
   automated match to d1yy7b2
   complexed with g4p, mg

Details for d6wegc2

PDB Entry: 6weg, 2.95 Å

PDB Description: structure of ft (mgla-sspa)-ppgpp-pigr peptide complex

PDB Compounds: (C:) Stringent starvation protein A, regulator of transcription

SCOPe Domain Sequences for d6wegc2:

Sequence; same for both SEQRES and ATOM records:

>d6wegc2 a.45.1.0 (C:80-194) automated matches {Francisella tularensis [TaxId: 177416]}
llpnvvnerikirlsldkidnewypvldqirkhrsdqkmlesmfkdlkesllamekaftg
seffissgftladcyiaaliicleaegfiiddeygaiyeykkrlfardsvkkani

Timeline for d6wegc2:

• d6wegc2 is new in SCOPe 2.07-stable
  
• d6wegc2 appears in the current release, SCOPe 2.08