Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class sigma GST [81362] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [89705] (15 PDB entries) Uniprot O60760 synonym: hematopoietic prostaglandin D synthase |
Domain d6w8ha1: 6w8h A:2-75 [396101] Other proteins in same PDB: d6w8ha2, d6w8hc2 automated match to d1pd212 complexed with edo, gsh, tjg |
PDB Entry: 6w8h (more details), 1.97 Å
SCOPe Domain Sequences for d6w8ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w8ha1 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl hqslaiaryltknt
Timeline for d6w8ha1: