Class a: All alpha proteins [46456] (289 folds) |
Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
Superfamily a.64.1: Saposin [47862] (5 families) Lipid-binding can promote conformational changes and oligomerisation in some members |
Family a.64.1.0: automated matches [191532] (1 protein) not a true family |
Protein automated matches [190901] (2 species) not a true protein |
Species Mus musculus [TaxId:10090] [396003] (4 PDB entries) |
Domain d6vzda_: 6vzd A: [396031] automated match to d4ddja_ complexed with rxy; mutant |
PDB Entry: 6vzd (more details), 1.88 Å
SCOPe Domain Sequences for d6vzda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vzda_ a.64.1.0 (A:) automated matches {Mus musculus [TaxId: 10090]} ndlcqecedivhlltkmtkedafqeairkfleqecdilplellvpecrqvldvylplvid yfqsqinpkaicnhvglcp
Timeline for d6vzda_: