Lineage for d6vlbb_ (6vlb B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517892Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2517893Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2518443Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2518444Protein automated matches [190965] (39 species)
    not a true protein
  7. 2518560Species Neisseria meningitidis [TaxId:122587] [395990] (2 PDB entries)
  8. 2518562Domain d6vlbb_: 6vlb B: [396025]
    automated match to d1f6dd_
    complexed with edo, na

Details for d6vlbb_

PDB Entry: 6vlb (more details), 1.85 Å

PDB Description: crystal structure of ligand-free udp-glcnac 2-epimerase from neisseria meningitidis
PDB Compounds: (B:) udp-n-acetylglucosamine 2-epimerase

SCOPe Domain Sequences for d6vlbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vlbb_ c.87.1.0 (B:) automated matches {Neisseria meningitidis [TaxId: 122587]}
mkvltvfgtrpeaikmapvilelqkhntitskvcitaqhremldqvlslfeikadydlni
mkpnqslqeittniissltdvledfkpdcvlvhgdttttfaaslaafyqkipvghieagl
rtynlyspwpeeanrrltsvlsqwhfaptedsknnllsesipsdkvivtgntvidalmvs
leklkittikkqmeqafpfiqdnskvilitahrrenhgegikniglsilelakkyptfsf
viplhlnpnvrkpiqdllssvhnvhliepqeylpfvylmskshiilsdsggiqeeapslg
kpvlvlrdtterpeavaagtvklvgsetqniiesftqlieypeyyekmanienpygigna
skiivetllknr

SCOPe Domain Coordinates for d6vlbb_:

Click to download the PDB-style file with coordinates for d6vlbb_.
(The format of our PDB-style files is described here.)

Timeline for d6vlbb_: