Lineage for d6w1bh_ (6w1b H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330098Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 2330099Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 2330160Family a.64.1.0: automated matches [191532] (1 protein)
    not a true family
  6. 2330161Protein automated matches [190901] (2 species)
    not a true protein
  7. 2330165Species Mus musculus [TaxId:10090] [396003] (4 PDB entries)
  8. 2330187Domain d6w1bh_: 6w1b H: [396023]
    automated match to d4ddja_
    complexed with pee; mutant

Details for d6w1bh_

PDB Entry: 6w1b (more details), 2.31 Å

PDB Description: n-terminal domain of mouse surfactant protein b with bound lipid, y59a/h79a mutant
PDB Compounds: (H:) Pulmonary surfactant-associated protein B

SCOPe Domain Sequences for d6w1bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w1bh_ a.64.1.0 (H:) automated matches {Mus musculus [TaxId: 10090]}
dlcqecedivhlltkmtkedafqeairkfleqecdilplkllvprcrqvldvalplvidy
fqsqinpkaicnavglcp

SCOPe Domain Coordinates for d6w1bh_:

Click to download the PDB-style file with coordinates for d6w1bh_.
(The format of our PDB-style files is described here.)

Timeline for d6w1bh_: