SCOPe 2.07: Domain d6th2b1: 6th2 B:186-412

Lineage for d6th2b1 (6th2 B:186-412)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.3: CoaB-like [102645] (2 families)
   combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest

5. Family c.72.3.0: automated matches [258365] (1 protein)
   not a true family

6. Protein automated matches [258366] (4 species)
   not a true protein

7. Species Mycolicibacterium smegmatis [TaxId:246196] [395766] (1 PDB entry)

8. Domain d6th2b1: 6th2 B:186-412 [395930]
   Other proteins in same PDB: d6th2a2, d6th2b2, d6th2c2, d6th2d2
   automated match to d1u7zb_
   complexed with act, ca, ctp, mes

Details for d6th2b1

PDB Entry: 6th2, 1.84 Å

PDB Description: crystal structure of mycobacterium smegmatis coab in complex with ctp

PDB Compounds: (B:) Coenzyme A biosynthesis bifunctional protein coaBC

SCOPe Domain Sequences for d6th2b1:

Sequence; same for both SEQRES and ATOM records:

>d6th2b1 c.72.3.0 (B:186-412) automated matches {Mycolicibacterium smegmatis [TaxId: 246196]}
dmagvkalvtaggtrepldpvrfignrssgkqgyavarvlaqrgadvtliagntaglidp
agvemvhigsatqlrdavskhapdanvlvmaaavadfrpahvaaakikkgasepssidlv
rnddvlagavraradgqlpnmraivgfaaetgdangdvlfharaklerkgcdllvvnavg
enrafevdhndgwllsadgtesalehgsktlmatrivdsiaaflksq

Timeline for d6th2b1:

• d6th2b1 is new in SCOPe 2.07-stable
  
• d6th2b1 appears in the current release, SCOPe 2.08