Lineage for d6uwda_ (6uwd A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2502162Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2502163Protein automated matches [190689] (81 species)
    not a true protein
  7. 2502164Species Actinomadura melliaura [TaxId:360723] [395868] (3 PDB entries)
  8. 2502167Domain d6uwda_: 6uwd A: [395892]
    automated match to d2o57d_
    complexed with act, mg

Details for d6uwda_

PDB Entry: 6uwd (more details), 2.04 Å

PDB Description: crystal structure of apo atmm
PDB Compounds: (A:) D-glucose O-methyltransferase

SCOPe Domain Sequences for d6uwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uwda_ c.66.1.0 (A:) automated matches {Actinomadura melliaura [TaxId: 360723]}
sdpfaglgagnihlgyfdgpddaatlaeaadrltdqliarlpvvrdhrvldvgcgvgkpa
lrlagdlgvrvvgvsiseaqigianeaaraagladrvsfryadamrlpfpdasfdgvwam
eslhhmpdrlqalreiarvlrhggvlsiadfvqlgpvreqdeealrafrsgggvhtltgi
aeyeaeiadagltltsssdisanvrpsmvrtaeairgaadaflplmgeeglrrlidnfer
aatvpqigyalfaarrs

SCOPe Domain Coordinates for d6uwda_:

Click to download the PDB-style file with coordinates for d6uwda_.
(The format of our PDB-style files is described here.)

Timeline for d6uwda_: