Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein automated matches [190514] (13 species) not a true protein |
Species Mycobacterium ulcerans [TaxId:362242] [395872] (5 PDB entries) |
Domain d6uwwa_: 6uww A: [395873] automated match to d2w3wa_ complexed with mmv, nap, so4 |
PDB Entry: 6uww (more details), 0.92 Å
SCOPe Domain Sequences for d6uwwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6uwwa_ c.71.1.1 (A:) automated matches {Mycobacterium ulcerans [TaxId: 362242]} svgliwaqstsgvigrdggipwrlpedlahfkrltmghtvvmgrrtwdslpaahrplpgr rnvvvtrqtglvahgaqvvgsleqalspaepdaetwviggaqiyalalplanrcevtevd vdlppededalapvldqtwagtsgewlvsrsglryrmhsyrrl
Timeline for d6uwwa_: