Lineage for d6uwwa_ (6uww A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2511402Protein automated matches [190514] (13 species)
    not a true protein
  7. 2511428Species Mycobacterium ulcerans [TaxId:362242] [395872] (5 PDB entries)
  8. 2511429Domain d6uwwa_: 6uww A: [395873]
    automated match to d2w3wa_
    complexed with mmv, nap, so4

Details for d6uwwa_

PDB Entry: 6uww (more details), 0.92 Å

PDB Description: crystal structure of dihydrofolate reductase from mycobacterium ulcerans with p218 inhibitor
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d6uwwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6uwwa_ c.71.1.1 (A:) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
svgliwaqstsgvigrdggipwrlpedlahfkrltmghtvvmgrrtwdslpaahrplpgr
rnvvvtrqtglvahgaqvvgsleqalspaepdaetwviggaqiyalalplanrcevtevd
vdlppededalapvldqtwagtsgewlvsrsglryrmhsyrrl

SCOPe Domain Coordinates for d6uwwa_:

Click to download the PDB-style file with coordinates for d6uwwa_.
(The format of our PDB-style files is described here.)

Timeline for d6uwwa_: