Class b: All beta proteins [48724] (178 folds) |
Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Bruton's tyrosine kinase [50738] (1 species) contains Btk zinc-binding motif |
Species Human (Homo sapiens) [TaxId:9606] [50739] (10 PDB entries) |
Domain d6tsea_: 6tse A: [395823] automated match to d1btka_ complexed with 72v, mg, zn; mutant |
PDB Entry: 6tse (more details), 1.41 Å
SCOPe Domain Sequences for d6tsea_:
Sequence, based on SEQRES records: (download)
>d6tsea_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} aavilesiflkrsqqkkktsplnfkkclflltvhklsyyeydfergrrgskkgsidveki tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqile
>d6tsea_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} aavilesiflkrsqqkkktsplnfkkclflltvhklsyyeydfergrrgskkgsidveki tcvetvvpeknppperqiprrgemeqisiierfpypfqvvydegplyvfspteelrkrwi hqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqile
Timeline for d6tsea_: