Lineage for d6t6ma1 (6t6m A:3-173)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2348932Fold a.175: Orange carotenoid protein, N-terminal domain [81929] (1 superfamily)
    multihelical; array
  4. 2348933Superfamily a.175.1: Orange carotenoid protein, N-terminal domain [81930] (2 families) (S)
    duplication: contains four structural repeats arranged into two intertwined 4-helical subdomains
    automatically mapped to Pfam PF09150
  5. 2348934Family a.175.1.1: Orange carotenoid protein, N-terminal domain [81931] (2 proteins)
  6. 2348939Protein automated matches [227037] (2 species)
    not a true protein
  7. 2348951Species Synechocystis sp. [TaxId:1148] [225877] (8 PDB entries)
  8. 2348953Domain d6t6ma1: 6t6m A:3-173 [395811]
    Other proteins in same PDB: d6t6ma2
    automated match to d5ui2a1
    complexed with ech, gol, his; mutant

Details for d6t6ma1

PDB Entry: 6t6m (more details), 1.49 Å

PDB Description: y201w mutant of the orange carotenoid protein from synechocystis at ph 5.5
PDB Compounds: (A:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d6t6ma1:

Sequence, based on SEQRES records: (download)

>d6t6ma1 a.175.1.1 (A:3-173) automated matches {Synechocystis sp. [TaxId: 1148]}
ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq
laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv
apipagyqlsananavlatiqglesgqqitvlrnavvdmgftagkdgkria

Sequence, based on observed residues (ATOM records): (download)

>d6t6ma1 a.175.1.1 (A:3-173) automated matches {Synechocystis sp. [TaxId: 1148]}
ftidsargifpntlaadvvpatiarfsqlnaedqlaliwfaylemgktltiaapgaasmq
laenalkeiqamgplqqtqamcdlanradtplcrtyaswspniklgfwyrlgelmeqgfv
apipagyqlsananavlatiqglesgqqitvlrnavvdmgftgkria

SCOPe Domain Coordinates for d6t6ma1:

Click to download the PDB-style file with coordinates for d6t6ma1.
(The format of our PDB-style files is described here.)

Timeline for d6t6ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6t6ma2