SCOPe 2.07: Domain d6tjlb_: 6tjl B:

Lineage for d6tjlb_ (6tjl B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.14: Phytochelatin synthase [142867] (2 proteins)
   Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit

6. Protein automated matches [395700] (1 species)
   not a true protein

7. Species Nostoc sp. [TaxId:103690] [395701] (3 PDB entries)

8. Domain d6tjlb_: 6tjl B: [395739]
   automated match to d2bu3a_
   complexed with ca, gsh

Details for d6tjlb_

PDB Entry: 6tjl, 1.87 Å

PDB Description: mature primitive pytochelatin synthase alr0975 from nostoc species bound to glutathione

PDB Compounds: (B:) alr0975 protein

SCOPe Domain Sequences for d6tjlb_:

Sequence; same for both SEQRES and ATOM records:

>d6tjlb_ d.3.1.14 (B:) automated matches {Nostoc sp. [TaxId: 103690]}
qtltlspnligfnsnegekllltsrsredffplsmqfvtqvnqaysgvasiimvlnslgi
napetaqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnha
sdtniedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsr
ykyppvwvkttdlwkamntvdsvsqktrgfvfvsktq

Timeline for d6tjlb_:

• d6tjlb_ is new in SCOPe 2.07-stable
  
• d6tjlb_ appears in the current release, SCOPe 2.08