SCOPe 2.07: Domain d6tbea1: 6tbe A:8-122

Lineage for d6tbea1 (6tbe A:8-122)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187279] (32 PDB entries)

8. Domain d6tbea1: 6tbe A:8-122 [395670]
   Other proteins in same PDB: d6tbea2
   automated match to d3vtva_
   complexed with edo, nov

Details for d6tbea1

PDB Entry: 6tbe, 1.67 Å

PDB Description: lc3a in complex with (3r,4s,5r,6r)-5-hydroxy-6-((4-hydroxy-3-(4- hydroxy-3-isopentylbenzamido)-8-methyl-2-oxo-2h-chromen-7-yl)oxy)-3- methoxy-2,2-dimethyltetrahydro-2h-pyran-4-yl carbamate

PDB Compounds: (A:) Microtubule-associated proteins 1A/1B light chain 3A

SCOPe Domain Sequences for d6tbea1:

Sequence; same for both SEQRES and ATOM records:

>d6tbea1 d.15.1.3 (A:8-122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drpfkqrrsfadrckevqqirdqhpskipviierykgekqlpvldktkflvpdhvnmsel
vkiirrrlqlnptqaffllvnqhsmvsvstpiadiyeqekdedgflymvyasqet

Timeline for d6tbea1:

• d6tbea1 is new in SCOPe 2.07-stable
  
• d6tbea1 appears in the current release, SCOPe 2.08