Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (24 species) not a true protein |
Species Escherichia coli [TaxId:562] [186939] (7 PDB entries) |
Domain d6lfka2: 6lfk A:595-750 [395386] Other proteins in same PDB: d6lfka1, d6lfkb1, d6lfkc1, d6lfkd1 automated match to d3p9qa2 complexed with hem |
PDB Entry: 6lfk (more details), 2.1 Å
SCOPe Domain Sequences for d6lfka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lfka2 c.23.16.0 (A:595-750) automated matches {Escherichia coli [TaxId: 562]} lksrqvailaadgvcgdaidnimktlkkygvhgkifaphvgritslqgneievngtiegn psvmvdaviipdgedsidslmkngnakhyviqafkhlkaiglqgkafklydalplpkpde givvgdkaadlaeafcnvmrghriwsresvaqeiag
Timeline for d6lfka2: