Lineage for d6lfka2 (6lfk A:595-750)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467511Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2467512Protein automated matches [190197] (24 species)
    not a true protein
  7. 2467614Species Escherichia coli [TaxId:562] [186939] (7 PDB entries)
  8. 2467636Domain d6lfka2: 6lfk A:595-750 [395386]
    Other proteins in same PDB: d6lfka1, d6lfkb1, d6lfkc1, d6lfkd1
    automated match to d3p9qa2
    complexed with hem

Details for d6lfka2

PDB Entry: 6lfk (more details), 2.1 Å

PDB Description: crystal structure of kate from atypical e. coli
PDB Compounds: (A:) eKatE catalase

SCOPe Domain Sequences for d6lfka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lfka2 c.23.16.0 (A:595-750) automated matches {Escherichia coli [TaxId: 562]}
lksrqvailaadgvcgdaidnimktlkkygvhgkifaphvgritslqgneievngtiegn
psvmvdaviipdgedsidslmkngnakhyviqafkhlkaiglqgkafklydalplpkpde
givvgdkaadlaeafcnvmrghriwsresvaqeiag

SCOPe Domain Coordinates for d6lfka2:

Click to download the PDB-style file with coordinates for d6lfka2.
(The format of our PDB-style files is described here.)

Timeline for d6lfka2: