SCOPe 2.07: Domain d6m32g_: 6m32 G:

Lineage for d6m32g_ (6m32 G:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
   single sheet; 16 strands; meander

4. Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family)
   automatically mapped to Pfam PF02327

5. Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 proteins)

6. Protein automated matches [190386] (4 species)
   not a true protein

7. Species Chlorobaculum tepidum [TaxId:194439] [395287] (1 PDB entry)

8. Domain d6m32g_: 6m32 G: [395288]
   automated match to d3bsda_
   complexed with bcl, ca, f26, f39, g2o, gs0, lhg, lmg, sf4

Details for d6m32g_

PDB Entry: 6m32, 2.7 Å

PDB Description: cryo-em structure of fmo-rc complex from green sulfur bacteria

PDB Compounds: (G:) Bacteriochlorophyll a protein

SCOPe Domain Sequences for d6m32g_:

Sequence; same for both SEQRES and ATOM records:

>d6m32g_ b.75.1.1 (G:) automated matches {Chlorobaculum tepidum [TaxId: 194439]}
vttahsdyeivleggssswgkvkarakvnappaspllpadcdvklnvkpldpakgfvris
avfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrsd
avrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfigp
aftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdkl
nrpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnfn
vdaqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvckggvgqfeilyaq

Timeline for d6m32g_:

• d6m32g_ is new in SCOPe 2.07-stable
  
• d6m32g_ appears in the current release, SCOPe 2.08