Lineage for d6lg0b_ (6lg0 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517892Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2517893Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2518443Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2518444Protein automated matches [190965] (39 species)
    not a true protein
  7. 2518618Species Scutellaria baicalensis [TaxId:65409] [395174] (1 PDB entry)
  8. 2518620Domain d6lg0b_: 6lg0 B: [395242]
    automated match to d2pq6a1
    complexed with udp

Details for d6lg0b_

PDB Entry: 6lg0 (more details), 3 Å

PDB Description: crystal structure of sbcgta in complex with udp
PDB Compounds: (B:) SbCGTa

SCOPe Domain Sequences for d6lg0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lg0b_ c.87.1.0 (B:) automated matches {Scutellaria baicalensis [TaxId: 65409]}
vgahialfpcagmghllpflrlaamldargcavtvitvkptvsaaesdhlsafftihpri
trlefqllpyqksglrnddpffiqmetiatsvhllrpllsslspplsaivsdftltsqvt
dlvsdlpistytlmtssaaffclmaylpkllqidvanrdaieipdlgpismssippkmld
psdffsafissnvsslhkvkgvlintfnsfeseaieavrrngvdhilpigplesydakka
hdlpwldeqppesvlfvsfgsrtalskeqirelgaaleksgcrflwvlkggkvdkedkee
vedmlgasfvertkkkglivkgwvkqeqilahpaiggfvshcgwnsvieaarlgvpvlaw
pqhgdqsvnagvvekaglglwvrewgwgqtkligreeiaekmievmqdeklrvsagevra
kaketrevdgdseallqrlihsfnn

SCOPe Domain Coordinates for d6lg0b_:

Click to download the PDB-style file with coordinates for d6lg0b_.
(The format of our PDB-style files is described here.)

Timeline for d6lg0b_: