Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) |
Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
Protein automated matches [190965] (39 species) not a true protein |
Species Scutellaria baicalensis [TaxId:65409] [395174] (1 PDB entry) |
Domain d6lg0b_: 6lg0 B: [395242] automated match to d2pq6a1 complexed with udp |
PDB Entry: 6lg0 (more details), 3 Å
SCOPe Domain Sequences for d6lg0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6lg0b_ c.87.1.0 (B:) automated matches {Scutellaria baicalensis [TaxId: 65409]} vgahialfpcagmghllpflrlaamldargcavtvitvkptvsaaesdhlsafftihpri trlefqllpyqksglrnddpffiqmetiatsvhllrpllsslspplsaivsdftltsqvt dlvsdlpistytlmtssaaffclmaylpkllqidvanrdaieipdlgpismssippkmld psdffsafissnvsslhkvkgvlintfnsfeseaieavrrngvdhilpigplesydakka hdlpwldeqppesvlfvsfgsrtalskeqirelgaaleksgcrflwvlkggkvdkedkee vedmlgasfvertkkkglivkgwvkqeqilahpaiggfvshcgwnsvieaarlgvpvlaw pqhgdqsvnagvvekaglglwvrewgwgqtkligreeiaekmievmqdeklrvsagevra kaketrevdgdseallqrlihsfnn
Timeline for d6lg0b_: