SCOPe 2.07: Domain d6l7da2: 6l7d A:140-423

Lineage for d6l7da2 (6l7d A:140-423)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (78 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [395131] (1 PDB entry)

8. Domain d6l7da2: 6l7d A:140-423 [395132]
   Other proteins in same PDB: d6l7da1
   automated match to d2pa6a2
   complexed with 2pg, act, mg, peg; mutant

Details for d6l7da2

PDB Entry: 6l7d, 3 Å

PDB Description: mycobacterium tuberculosis enolase mutant - s42a

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d6l7da2:

Sequence; same for both SEQRES and ATOM records:

>d6l7da2 c.1.11.0 (A:140-423) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ilpvpmmnilnggahadtavdiqefmvapigapsfvealrwgaevyhalksvlkkeglst
glgdeggfapdvagttaaldlisraiesaglrpgadvalaldaaatefftdgtgyvfegt
trtadqmtefyagllgayplvsiedplseddwdgwaaltasigdrvqivgddifvtnper
leegiergvanallvkvnqigtltetldavtlahhggyrtmishrsgetedtmiadlava
igsgqiktgaparservakynqllrieealgdaaryagdlafpr

Timeline for d6l7da2:

• d6l7da2 is new in SCOPe 2.07-stable
  
• d6l7da2 appears in the current release, SCOPe 2.08