SCOPe 2.07: Domain d7kehb1: 7keh B:1-190

Lineage for d7kehb1 (7keh B:1-190)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (2 proteins)
   rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain

6. Protein automated matches [381979] (2 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382217] (33 PDB entries)

8. Domain d7kehb1: 7keh B:1-190 [394976]
   Other proteins in same PDB: d7keha2, d7keha3, d7kehb2, d7kehb3
   automated match to d2rhba1
   complexed with b3p, so4

Details for d7kehb1

PDB Entry: 7keh, 2.59 Å

PDB Description: crystal structure from sars-cov-2 nendou nsp15

PDB Compounds: (B:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d7kehb1:

Sequence; same for both SEQRES and ATOM records:

>d7kehb1 c.66.1.48 (B:1-190) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
slenvafnvvnkghfdgqqgevpvsiinntvytkvdgvdvelfenkttlpvnvafelwak
rnikpvpevkilnnlgvdiaantviwdykrdapahistigvcsmtdiakkpteticaplt
vffdgrvdgqvdlfrnarngvlitegsvkglqpsvgpkqaslngvtligeavktqfnyyk
kvdgvvqqlp

Timeline for d7kehb1:

• d7kehb1 is new in SCOPe 2.07-stable
  
• d7kehb1 appears in the current release, SCOPe 2.08