Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (2 proteins) rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain |
Protein automated matches [381979] (2 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [382217] (33 PDB entries) |
Domain d7kehb1: 7keh B:1-190 [394976] Other proteins in same PDB: d7keha2, d7keha3, d7kehb2, d7kehb3 automated match to d2rhba1 complexed with b3p, so4 |
PDB Entry: 7keh (more details), 2.59 Å
SCOPe Domain Sequences for d7kehb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kehb1 c.66.1.48 (B:1-190) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} slenvafnvvnkghfdgqqgevpvsiinntvytkvdgvdvelfenkttlpvnvafelwak rnikpvpevkilnnlgvdiaantviwdykrdapahistigvcsmtdiakkpteticaplt vffdgrvdgqvdlfrnarngvlitegsvkglqpsvgpkqaslngvtligeavktqfnyyk kvdgvvqqlp
Timeline for d7kehb1: