SCOPe 2.07: Domain d7kn1b1: 7kn1 B:1-335

Lineage for d7kn1b1 (7kn1 B:1-335)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Stenotrophomonas maltophilia [TaxId:522373] [394908] (1 PDB entry)

8. Domain d7kn1b1: 7kn1 B:1-335 [394957]
   Other proteins in same PDB: d7kn1a2, d7kn1b2
   automated match to d2pzja_
   complexed with edo, nad, wqd

Details for d7kn1b1

PDB Entry: 7kn1, 1.45 Å

PDB Description: crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound nad and formylated udp- arabinopyranose

PDB Compounds: (B:) UDP-glucose 4-epimerase

SCOPe Domain Sequences for d7kn1b1:

Sequence; same for both SEQRES and ATOM records:

>d7kn1b1 c.2.1.0 (B:1-335) automated matches {Stenotrophomonas maltophilia [TaxId: 522373]}
mnvlvtggagyigshacvelqqqghgvvivdslcnsdasvverigritgtapvfvqadir
drprmaalmqehaidavlhfaalksvgesqkiplqyfdsnisgsiallgamqdagvqllv
fsssatvygnqdhcpvaetastcamtpygrtklvveqlladlaatgqdlhiatlryfnpv
gahasaligelphgtpsnlmpyiaqvaagllpevqvfgddypthdgtgvrdyihvqdvas
ahvlalqflrdqrrsitlnlgtgqghsvleliqafelttgvrvpfrivprrdgdiavsfa
daslalrelgwkarhdltdmcrdtwkwqramsraa

Timeline for d7kn1b1:

• d7kn1b1 is new in SCOPe 2.07-stable
  
• d7kn1b1 appears in the current release, SCOPe 2.08