Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (33 PDB entries) |
Domain d7kola1: 7kol A:7-61 [394938] Other proteins in same PDB: d7kola2 automated match to d5tl6b1 complexed with cl, mes, y96, zn |
PDB Entry: 7kol (more details), 2.58 Å
SCOPe Domain Sequences for d7kola1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7kola1 d.15.1.0 (A:7-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]} vfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpnd
Timeline for d7kola1: