Lineage for d7kola1 (7kol A:7-61)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540644Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (33 PDB entries)
  8. 2540676Domain d7kola1: 7kol A:7-61 [394938]
    Other proteins in same PDB: d7kola2
    automated match to d5tl6b1
    complexed with cl, mes, y96, zn

Details for d7kola1

PDB Entry: 7kol (more details), 2.58 Å

PDB Description: the crystal structure of papain-like protease of sars cov-2 in complex with plp_snyder496 inhibitor
PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d7kola1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kola1 d.15.1.0 (A:7-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
vfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpnd

SCOPe Domain Coordinates for d7kola1:

Click to download the PDB-style file with coordinates for d7kola1.
(The format of our PDB-style files is described here.)

Timeline for d7kola1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7kola2