SCOPe 2.07: Domain d7kdwa_: 7kdw A:

Lineage for d7kdwa_ (7kdw A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d7kdwa_: 7kdw A: [394906]
   automated match to d3uv2a_
   complexed with edo, wcv

Details for d7kdwa_

PDB Entry: 7kdw, 1.71 Å

PDB Description: crystal structure of the bromodomain (bd) of human bromodomain and phd finger-containing transcription factor (bptf) bound to compound 6 (hz01052)

PDB Compounds: (A:) Nucleosome-remodeling factor subunit BPTF

SCOPe Domain Sequences for d7kdwa_:

Sequence; same for both SEQRES and ATOM records:

>d7kdwa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdlatmeervq
rryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfkasr

Timeline for d7kdwa_:

• d7kdwa_ is new in SCOPe 2.07-stable
  
• d7kdwa_ appears in the current release, SCOPe 2.08