SCOPe 2.07: Domain d7k7eb2: 7k7e B:200-380

Lineage for d7k7eb2 (7k7e B:200-380)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families)
   automatically mapped to Pfam PF02764

5. Family f.1.2.0: automated matches [254320] (1 protein)
   not a true family

6. Protein automated matches [254734] (1 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [256177] (7 PDB entries)

8. Domain d7k7eb2: 7k7e B:200-380 [394852]
   Other proteins in same PDB: d7k7ea1, d7k7ea3, d7k7ea4, d7k7eb1, d7k7eb3, d7k7eb4
   automated match to d1ddta3

Details for d7k7eb2

PDB Entry: 7k7e, 2.3 Å

PDB Description: crystal structure of diphtheria toxin from crystals obtained at ph 7.0

PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d7k7eb2:

Sequence, based on SEQRES records:

>d7k7eb2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

Sequence, based on observed residues (ATOM records):

>d7k7eb2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvgfaaynfvesiinlfqvvhnsynrpay

Timeline for d7k7eb2:

• d7k7eb2 is new in SCOPe 2.07-stable
  
• d7k7eb2 appears in the current release, SCOPe 2.08