Lineage for d7k6ra1 (7k6r A:2917-3037)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2320546Domain d7k6ra1: 7k6r A:2917-3037 [394808]
    Other proteins in same PDB: d7k6ra2
    automated match to d3uv2a_
    complexed with 9st, edo

Details for d7k6ra1

PDB Entry: 7k6r (more details), 1.6 Å

PDB Description: crystal structure of the bromodomain (bd) of human bromodomain and phd finger-containing transcription factor (bptf) bound to gsk4027
PDB Compounds: (A:) Nucleosome-remodeling factor subunit BPTF

SCOPe Domain Sequences for d7k6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7k6ra1 a.29.2.0 (A:2917-3037) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stedamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdlat
meervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfkasrs
h

SCOPe Domain Coordinates for d7k6ra1:

Click to download the PDB-style file with coordinates for d7k6ra1.
(The format of our PDB-style files is described here.)

Timeline for d7k6ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d7k6ra2