Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries) |
Domain d7k6ra1: 7k6r A:2917-3037 [394808] Other proteins in same PDB: d7k6ra2 automated match to d3uv2a_ complexed with 9st, edo |
PDB Entry: 7k6r (more details), 1.6 Å
SCOPe Domain Sequences for d7k6ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7k6ra1 a.29.2.0 (A:2917-3037) automated matches {Human (Homo sapiens) [TaxId: 9606]} stedamtvltpltekdyeglkrvlrslqahkmawpflepvdpndapdyygvikepmdlat meervqrryyekltefvadmtkifdncryynpsdspfyqcaevlesffvqklkgfkasrs h
Timeline for d7k6ra1: