Lineage for d7kcdd_ (7kcd D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2341332Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2342566Protein automated matches [190059] (14 species)
    not a true protein
  7. 2342588Species Human (Homo sapiens) [TaxId:9606] [187214] (212 PDB entries)
  8. 2342636Domain d7kcdd_: 7kcd D: [394785]
    automated match to d3q95b_
    complexed with rl4

Details for d7kcdd_

PDB Entry: 7kcd (more details), 1.8 Å

PDB Description: estrogen receptor alpha ligand binding domain in complex with a methylated lasofoxifene derivative that increases receptor resonance time in the nucleus of breast cancer cells
PDB Compounds: (D:) Estrogen receptor

SCOPe Domain Sequences for d7kcdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7kcdd_ a.123.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvpg
fvdltlhdqvhllesawleilmiglvwrsmehpgkllfapnllldrnqgksvegmveifd
mllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmksknvvpsydllleml

SCOPe Domain Coordinates for d7kcdd_:

Click to download the PDB-style file with coordinates for d7kcdd_.
(The format of our PDB-style files is described here.)

Timeline for d7kcdd_: