Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein automated matches [190085] (58 species) not a true protein |
Species Mycolicibacterium fortuitum [TaxId:1766] [394676] (1 PDB entry) |
Domain d7k73g_: 7k73 G: [394713] automated match to d2ntva_ complexed with act, edo, nad |
PDB Entry: 7k73 (more details), 1.8 Å
SCOPe Domain Sequences for d7k73g_:
Sequence, based on SEQRES records: (download)
>d7k73g_ c.2.1.2 (G:) automated matches {Mycolicibacterium fortuitum [TaxId: 1766]} agllegkrilvtgiitdssiafhiakvaqeagaelvltgfdrmkliqriadrlpkpapll eldvqneehlasladrisgaigegnkldgvvhsigfmpqtgmgvnpffdapyadvakgih isaysyaslakatlpimneggsivgmdfdptrampaynwmtvaksalesvnrfvareaga agvrsnlvaagpirtlamsaivggalgdeagkqmqlleegwdqrapigwnmkdptpvakt vcallsdwmpattgtiiyadggastqll
>d7k73g_ c.2.1.2 (G:) automated matches {Mycolicibacterium fortuitum [TaxId: 1766]} agllegkrilvtgiitdssiafhiakvaqeagaelvltgfdrmkliqriadrlpkpapll eldvqneehlasladrisgaigegnkldgvvhsigfmpqtgmgvnpffdapyadvakgih isaysyaslakatlpimneggsivgmdfdptrampaynwmtvaksalesvnrfvareaga agvrsnlvaagpirtlamsaivggaeagkqmqlleegwdqrapigwnmkdptpvaktvca llsdwmpattgtiiyadggastqll
Timeline for d7k73g_: