Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries) |
Domain d6jvfa_: 6jvf A: [394644] automated match to d1irya_ |
PDB Entry: 6jvf (more details), 1.73 Å
SCOPe Domain Sequences for d6jvfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jvfa_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} asrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesgltvd alhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpddsy wfplllqkkkfhgyfkfqgqdtildytlrevdtv
Timeline for d6jvfa_: