SCOPe 2.07: Domain d7cufa2: 7cuf A:159-310

Lineage for d7cufa2 (7cuf A:159-310)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein automated matches [254656] (4 species)
   not a true protein

7. Species Bacillus sp. [TaxId:36824] [312567] (14 PDB entries)

8. Domain d7cufa2: 7cuf A:159-310 [394514]
   automated match to d1j2ga2
   complexed with aza, mxe, na, oxy, so4

Details for d7cufa2

PDB Entry: 7cuf, 1.46 Å

PDB Description: crystal structure of urate oxidase from bacillus sp. tb-90 in the absence from chloride anion at 1.44 a resolution

PDB Compounds: (A:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d7cufa2:

Sequence; same for both SEQRES and ATOM records:

>d7cufa2 d.96.1.4 (A:159-310) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeipesegkvyteprppygfqcftvtq

Timeline for d7cufa2:

• d7cufa2 is new in SCOPe 2.07-stable
  
• d7cufa2 appears in the current release, SCOPe 2.08