SCOPe 2.03: Domain d1cjub_: 1cju B:

Lineage for d1cjub_ (1cju B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins)
   Pfam PF00211
   structurally similar to the "palm" domain of DNA/RNA polymerase superfamily

6. Protein Adenylyl cyclase IIC1, domain C2a [55079] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [55080] (7 PDB entries)

8. Domain d1cjub_: 1cju B: [39427]
   Other proteins in same PDB: d1cjua_, d1cjuc1, d1cjuc2
   complexed with cl, dad, fok, gsp, mg

Details for d1cjub_

PDB Entry: 1cju, 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp and mg

PDB Compounds: (B:) adenylate cyclase, type II

SCOPe Domain Sequences for d1cjub_:

Sequence, based on SEQRES records:

>d1cjub_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsaipsqehaqeperqymhigtmvefayalvgkldainkhsfndfklr
vginhgpviagvigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytct
crgiinvkgkgdlktyfvnt

Sequence, based on observed residues (ATOM records):

>d1cjub_ d.58.29.1 (B:) Adenylyl cyclase IIC1, domain C2a {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yhqsydcvcvmfasipdfkefytesdvnkegleclrllneiiadfddllskpkfsgveki
ktigstymaatglsarqymhigtmvefayalvgkldainkhsfndfklrvginhgpviag
vigaqkpqydiwgntvnvasrmdstgvldkiqvteetslilqtlgytctcrgiinvkgkg
dlktyfvnt

Timeline for d1cjub_:

• d1cjub_ first appeared (with stable ids) in SCOP 1.55
  
• d1cjub_ appears in SCOPe 2.02
  
• d1cjub_ appears in SCOPe 2.04
  
• d1cjub_ appears in the current release, SCOPe 2.08