Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
Protein automated matches [190292] (37 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [189019] (3 PDB entries) |
Domain d7a20c_: 7a20 C: [394235] Other proteins in same PDB: d7a20b_, d7a20d_ automated match to d4ht3a_ complexed with 144, na |
PDB Entry: 7a20 (more details), 2.5 Å
SCOPe Domain Sequences for d7a20c_:
Sequence, based on SEQRES records: (download)
>d7a20c_ c.1.2.0 (C:) automated matches {Salmonella typhimurium [TaxId: 90371]} meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki ieknlaspkqmlaelrsfvsamkaasr
>d7a20c_ c.1.2.0 (C:) automated matches {Salmonella typhimurium [TaxId: 90371]} meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsie klkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlaspkqmlaelrsf vsamkaasr
Timeline for d7a20c_: