SCOPe 2.07: Domain d6ztqf1: 6ztq F:9-253

Lineage for d6ztqf1 (6ztq F:9-253)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (2 families)

5. Family c.142.1.0: automated matches [394200] (1 protein)
   not a true family

6. Protein automated matches [394201] (1 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [394202] (4 PDB entries)

8. Domain d6ztqf1: 6ztq F:9-253 [394222]
   Other proteins in same PDB: d6ztqf2, d6ztqf3, d6ztqt_, d6ztqu_
   automated match to d2fug12
   complexed with 3pe, atp, cdl, ehz, fes, fmn, hqh, ndp, pc1, sf4, zn

Details for d6ztqf1

PDB Entry: 6ztq, 3 Å

PDB Description: cryo-em structure of respiratory complex i from mus musculus inhibited by piericidin a at 3.0 a

PDB Compounds: (F:) nadh dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

SCOPe Domain Sequences for d6ztqf1:

Sequence; same for both SEQRES and ATOM records:

>d6ztqf1 c.142.1.0 (F:9-253) automated matches {Mus musculus [TaxId: 10090]}
ktsfgslkdedriftnlygrhdwrlkgalrrgdwyktkeillkgpdwilgemktsglrgr
ggagfptglkwsfmnkpsdgrpkylvvnadegepgtckdreimrhdphklvegclvggra
mgaraayiyirgefyneasnlqvaireayeagligknacgsdydfdvfvvrgagayicge
etaliesiegkqgkprlkppfpadvgvfgcpttvanvetvavspticrrggtwfagfgre
rnsgt

Timeline for d6ztqf1:

• d6ztqf1 is new in SCOPe 2.07-stable
  
• d6ztqf1 appears in the current release, SCOPe 2.08