Lineage for d6zzsb_ (6zzs B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2454188Species Acinetobacter baumannii [TaxId:470] [365483] (11 PDB entries)
  8. 2454198Domain d6zzsb_: 6zzs B: [394221]
    automated match to d1zjya1
    complexed with nad, qt8

Details for d6zzsb_

PDB Entry: 6zzs (more details), 1.85 Å

PDB Description: crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate
PDB Compounds: (B:) 3-hydroxybutyrate dehydrogenase

SCOPe Domain Sequences for d6zzsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zzsb_ c.2.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
tklldgkvafitgsasgigleiakkfaqegakvvisdmnaekcqetanslkeqgfdalsa
pcdvtdedaykqaieltqktfgtvdilinnagfqhvapieefptavfqklvqvmltgafi
gikhvlpimkaqkygriinmasingligfagkagynsakhgvigltkvaalecardgitv
nalcpgyvdtplvrgqiadlaktrnvsldsaledvilamvpqkrllsveeiadyaiflas
skaggvtgqavvmdggytaq

SCOPe Domain Coordinates for d6zzsb_:

Click to download the PDB-style file with coordinates for d6zzsb_.
(The format of our PDB-style files is described here.)

Timeline for d6zzsb_: