Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.29: Nucleotide cyclase [55073] (3 families) common fold is elaborated with additional secondary structures |
Family d.58.29.1: Adenylyl and guanylyl cyclase catalytic domain [55074] (6 proteins) Pfam PF00211 structurally similar to the "palm" domain of DNA/RNA polymerase superfamily |
Protein Adenylyl cyclase VC1, domain C1a [55077] (1 species) |
Species Dog (Canis familiaris) [TaxId:9615] [55078] (15 PDB entries) Uniprot P30803 458-646 |
Domain d1cjka_: 1cjk A: [39421] Other proteins in same PDB: d1cjkb_, d1cjkc1, d1cjkc2 complexed with cl, fok, gsp, mes, mg, mn, tat |
PDB Entry: 1cjk (more details), 3 Å
SCOPe Domain Sequences for d1cjka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cjka_ d.58.29.1 (A:) Adenylyl cyclase VC1, domain C1a {Dog (Canis familiaris) [TaxId: 9615]} mmfhkiyiqkhdnvsilfadiegftslasqctaqelvmtlnelfarfdklaaenhclrik ilgdcyycvsglpearadhahccvemgmdmieaislvremtgvnvnmrvgihsgrvhcgv lglrkwqfdvwsndvtlanhmeaggkagrihitkatlsylngdyevepgcggernaylke hsietflil
Timeline for d1cjka_: