Lineage for d6zzoc_ (6zzo C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456569Species Psychrobacter arcticus [TaxId:334543] [394191] (2 PDB entries)
  8. 2456572Domain d6zzoc_: 6zzo C: [394192]
    automated match to d4cqmh_
    complexed with aae, nad

Details for d6zzoc_

PDB Entry: 6zzo (more details), 1.28 Å

PDB Description: crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate
PDB Compounds: (C:) Putative beta-hydroxybutyrate dehydrogenase

SCOPe Domain Sequences for d6zzoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zzoc_ c.2.1.0 (C:) automated matches {Psychrobacter arcticus [TaxId: 334543]}
atqlqqdltgkvalvtgaasgigrdiaetyakagaavgiadinleaaqktvdaieaaggr
alaiamdvtseaavndgvqrlvdtfggidilvsnagiqiidpihkmafedwkkmlaihld
gaflttkaaiqhmykddkggtviymgsvhsheaslfkapyvtakhgllglcrvlakegav
hnvrshvicpgfvktplvekqipqqaaekgiseesvvndimlvntvdkefttvddiaqla
lflaafptnvftgqsivashgwfmn

SCOPe Domain Coordinates for d6zzoc_:

Click to download the PDB-style file with coordinates for d6zzoc_.
(The format of our PDB-style files is described here.)

Timeline for d6zzoc_: