Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (24 species) not a true protein |
Species Escherichia coli [TaxId:83333] [370657] (5 PDB entries) |
Domain d6ztwb2: 6ztw B:598-753 [394163] Other proteins in same PDB: d6ztwa1, d6ztwb1, d6ztwc1, d6ztwd1, d6ztwe1, d6ztwf1, d6ztwg1, d6ztwh1 automated match to d1p80a1 complexed with edo, gol, hdd, mpd, trs |
PDB Entry: 6ztw (more details), 1.84 Å
SCOPe Domain Sequences for d6ztwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ztwb2 c.23.16.0 (B:598-753) automated matches {Escherichia coli [TaxId: 83333]} vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg iveadsadgsfmdelltlmaahrvwsripkidkipa
Timeline for d6ztwb2: