SCOPe 2.07: Domain d6zmcc_: 6zmc C:

Lineage for d6zmcc_ (6zmc C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.7: MiaE-like [158405] (2 proteins)
   Pfam PF06175; tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)

6. Protein Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 [158406] (1 species)

7. Species Pseudomonas putida [TaxId:303] [158407] (3 PDB entries)
   Uniprot Q88KV1 3-201

8. Domain d6zmcc_: 6zmc C: [394116]
   automated match to d2itba1
   complexed with ar, ca, cl, fe, peg, pg4, trs

Details for d6zmcc_

PDB Entry: 6zmc, 2.5 Å

PDB Description: structure of the trna-monooxygenase enzyme miae frozen under 2000 bar using the high pressure freezing method

PDB Compounds: (C:) tRNA hydroxylase

SCOPe Domain Sequences for d6zmcc_:

Sequence; same for both SEQRES and ATOM records:

>d6zmcc_ a.25.1.7 (C:) Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Pseudomonas putida [TaxId: 303]}
slipeidaflgcptpdawieaaladqetllidhkncefkaastalsliakynthldlinm
msrlareelvhheqvlrlmkrrgvplrpvsagryasglrrlvrahepvklvdtlvvgafi
earscerfaalvphldeelgrfyhgllksearhyqgylklahnygdeadiarrvelvraa
emeliqspdqelrfhsgipq

Timeline for d6zmcc_:

• d6zmcc_ is new in SCOPe 2.07-stable
  
• d6zmcc_ appears in the current release, SCOPe 2.08