Lineage for d6zmub_ (6zmu B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487428Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (17 PDB entries)
  8. 2487453Domain d6zmub_: 6zmu B: [394096]
    automated match to d2xbqa_
    complexed with na, so4

Details for d6zmub_

PDB Entry: 6zmu (more details), 1.95 Å

PDB Description: crystal structure of the germline-specific thioredoxin protein deadhead (thioredoxin-1) from drospohila melanogaster, p43212
PDB Compounds: (B:) Thioredoxin-1

SCOPe Domain Sequences for d6zmub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zmub_ c.47.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
masvrtmndyhkrieaaddklivldfyatwcgpckemestvkslarkysskavvlkidvd
kfeelterykvrsmptfvflrqnrrlasfagadehkltnmmaklv

SCOPe Domain Coordinates for d6zmub_:

Click to download the PDB-style file with coordinates for d6zmub_.
(The format of our PDB-style files is described here.)

Timeline for d6zmub_: