Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
Protein Protein phosphatase-1 (PP-1) [56311] (6 species) |
Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (17 PDB entries) Uniprot P37140 1-308 |
Domain d6zeek1: 6zee K:7-299 [393934] Other proteins in same PDB: d6zeea2, d6zeeb2, d6zeei2, d6zeek2, d6zeep2, d6zeeq2 automated match to d1s70a_ complexed with 16p, edo, gol, mn, so4 |
PDB Entry: 6zee (more details), 1.9 Å
SCOPe Domain Sequences for d6zeek1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zeek1 d.159.1.3 (K:7-299) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]} lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
Timeline for d6zeek1: