SCOPe 2.07: Domain d6zeek1: 6zee K:7-299

Lineage for d6zeek1 (6zee K:7-299)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (6 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (17 PDB entries)
   Uniprot P37140 1-308

8. Domain d6zeek1: 6zee K:7-299 [393934]
   Other proteins in same PDB: d6zeea2, d6zeeb2, d6zeei2, d6zeek2, d6zeep2, d6zeeq2
   automated match to d1s70a_
   complexed with 16p, edo, gol, mn, so4

Details for d6zeek1

PDB Entry: 6zee, 1.9 Å

PDB Description: structure of pp1(7-300) bound to phactr1 (507-580) at ph8.4

PDB Compounds: (K:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d6zeek1:

Sequence; same for both SEQRES and ATOM records:

>d6zeek1 d.159.1.3 (K:7-299) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

Timeline for d6zeek1:

• d6zeek1 is new in SCOPe 2.07-stable
  
• d6zeek1 appears in the current release, SCOPe 2.08