Lineage for d6zgvd1 (6zgv D:8-216)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537678Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)
  6. 2537745Protein automated matches [232306] (2 species)
    not a true protein
  7. 2537746Species Homo sapiens [TaxId:9606] [362871] (13 PDB entries)
  8. 2537757Domain d6zgvd1: 6zgv D:8-216 [393914]
    Other proteins in same PDB: d6zgva2, d6zgvb2, d6zgvd2, d6zgve2
    automated match to d1wuua1
    complexed with gal, hfk, qkz

Details for d6zgvd1

PDB Entry: 6zgv (more details), 2.3 Å

PDB Description: structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide
PDB Compounds: (D:) Galactokinase

SCOPe Domain Sequences for d6zgvd1:

Sequence, based on SEQRES records: (download)

>d6zgvd1 d.14.1.5 (D:8-216) automated matches {Homo sapiens [TaxId: 9606]}
qvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlvgsp
rkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpgfsa
vvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgimdq
fislmgqkghallidcrsletslvplsdp

Sequence, based on observed residues (ATOM records): (download)

>d6zgvd1 d.14.1.5 (D:8-216) automated matches {Homo sapiens [TaxId: 9606]}
qvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlvgsp
rkdglvsllttqrlqfplptaqrslepgtprwanyvkgviqyypaaplpgfsavvvssvp
lggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfimdqfislmgqkghall
idcrsletslvplsdp

SCOPe Domain Coordinates for d6zgvd1:

Click to download the PDB-style file with coordinates for d6zgvd1.
(The format of our PDB-style files is described here.)

Timeline for d6zgvd1: