SCOPe 2.07: Domain d6z67b1: 6z67 B:2-229

Lineage for d6z67b1 (6z67 B:2-229)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (156 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:1313] [393850] (3 PDB entries)

8. Domain d6z67b1: 6z67 B:2-229 [393855]
   Other proteins in same PDB: d6z67b2, d6z67c2, d6z67e2
   automated match to d4p32b_
   complexed with adp, anp

Details for d6z67b1

PDB Entry: 6z67, 2.4 Å

PDB Description: ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution

PDB Compounds: (B:) Cell division ATP-binding protein FtsE

SCOPe Domain Sequences for d6z67b1:

Sequence; same for both SEQRES and ATOM records:

>d6z67b1 c.37.1.0 (B:2-229) automated matches {Streptococcus pneumoniae [TaxId: 1313]}
siiemrdvvkkydngttalrgvsvsvqpgefayivgpsgagkstfirslyrevkidkgsl
svagfnlvkikkkdvpllrrsvgvvfqdykllpkktvyeniayamevigenrrnikrrvm
evldlvglkhkvrsfpnelsggeqqriaiaraivnnpkvliadeptgnldpdnsweimnl
lerinlqgttilmathnsqivntlrhrviaiengrvvrdeskgeygyd

Timeline for d6z67b1:

• d6z67b1 is new in SCOPe 2.07-stable
  
• d6z67b1 appears in the current release, SCOPe 2.08