Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (156 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:1313] [393850] (3 PDB entries) |
Domain d6z4wa_: 6z4w A: [393851] automated match to d6b8ba_ complexed with adp |
PDB Entry: 6z4w (more details), 1.36 Å
SCOPe Domain Sequences for d6z4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6z4wa_ c.37.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 1313]} msiiemrdvvkkydngttalrgvsvsvqpgefayivgpsgagkstfirslyrevkidkgs lsvagfnlvkikkkdvpllrrsvgvvfqdykllpkktvyeniayamevigenrrnikrrv mevldlvglkhkvrsfpnelsggeqqriaiaraivnnpkvliadeptgnldpdnsweimn llerinlqgttilmathnsqivntlrhrviaiengrvvrdeskgeygydd
Timeline for d6z4wa_: