Lineage for d6z4wa_ (6z4w A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2480929Species Streptococcus pneumoniae [TaxId:1313] [393850] (3 PDB entries)
  8. 2480930Domain d6z4wa_: 6z4w A: [393851]
    automated match to d6b8ba_
    complexed with adp

Details for d6z4wa_

PDB Entry: 6z4w (more details), 1.36 Å

PDB Description: ftse structure from streptococcus pneumoniae in complex with adp (space group p 1)
PDB Compounds: (A:) Cell division ATP-binding protein FtsE

SCOPe Domain Sequences for d6z4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6z4wa_ c.37.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 1313]}
msiiemrdvvkkydngttalrgvsvsvqpgefayivgpsgagkstfirslyrevkidkgs
lsvagfnlvkikkkdvpllrrsvgvvfqdykllpkktvyeniayamevigenrrnikrrv
mevldlvglkhkvrsfpnelsggeqqriaiaraivnnpkvliadeptgnldpdnsweimn
llerinlqgttilmathnsqivntlrhrviaiengrvvrdeskgeygydd

SCOPe Domain Coordinates for d6z4wa_:

Click to download the PDB-style file with coordinates for d6z4wa_.
(The format of our PDB-style files is described here.)

Timeline for d6z4wa_: